MTUS1 Rabbit Polyclonal Antibody
Frequently bought together (2)
Other products for "MTUS1"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MTUS1 antibody: synthetic peptide directed towards the middle region of human MTUS1. Synthetic peptide located within the following region: KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 141 kDa |
Gene Name | microtubule associated tumor suppressor 1 |
Database Link | |
Background | MTUS1 contains a C-terminal domain and is able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. One of the isoforms has been shown to be a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other isoforms may be nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways. This gene encodes a protein which contains a C-terminal domain able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the transcript variants has been shown to encode a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other variants may encode nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways. |
Synonyms | ATBP; ATIP; ICIS; MP44; MTSG1 |
Note | Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Pig: 86%; Rabbit: 86%; Guinea pig: 86% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.