SLC26A8 Rabbit Polyclonal Antibody

CAT#: TA334070

Rabbit Polyclonal Anti-SLC26A8 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Transient overexpression lysate of solute carrier family 26, member 8 (SLC26A8), transcript variant 1
    • 100 ug

USD 665.00

Other products for "SLC26A8"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-SLC26A8 Antibody is: synthetic peptide directed towards the middle region of Human SLC26A8. Synthetic peptide located within the following region: VPYTVSSVSQKNQGQQYEEVEEVWLPNNSSRNSSPGLPDVAESQGRRSLI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 60 kDa
Gene Name solute carrier family 26 member 8
Background SLC26A8 is one member of a family of sulfate/anion transporters. Family members are well conserved in their protein (aa length among species) structures yet have markedly different tissue expression patterns.
Synonyms SPGF3; TAT1
Note Immunogen sequence homology: Human: 100%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.