DIPK2B Rabbit Polyclonal Antibody

CAT#: TA331576

Reviews ()
Write a review

Rabbit Polyclonal Anti-CXorf36 Antibody



Promo! Get it for USD 289.00, only with code 289*.

(*) Valid from April 1st to September 30th, 2020. See details »

USD 375.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-CXorf36 Antibody is: synthetic peptide directed towards the N-terminal region of Human CXorf36. Synthetic peptide located within the following region: GLDKCNACIGTSICKKFFKEEIRSDNWLASHLGLPPDSLLSYPANYSDDS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 47 kDa
Gene Name chromosome X open reading frame 36
Background The function of this protein remains unknown.
Synonyms 4930578C19Rik; bA435K1.1; DIA1R; EPQL1862; PRO3743
Note Immunogen sequence homology: Human: 100%; Pig: 92%; Bovine: 92%; Dog: 86%; Horse: 86%; Mouse: 86%; Rat: 79%; Rabbit: 79%
Reference Data
Protein Families Secreted Protein
Other products for "DIPK2B"
Frequently bought together (2)
Transient overexpression lysate of chromosome X open reading frame 36 (CXorf36), transcript variant 1
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies