Germany
Japan
United Kingdom
China
BEX4 Rabbit Polyclonal Antibody
Product Images
Frequently bought together (3)
Recombinant protein of human brain expressed, X-linked 4 (BEX4), transcript variant 2, 20 µg
USD 867.00
Transient overexpression lysate of brain expressed, X-linked 4 (BEX4), transcript variant 2
USD 436.00
Other products for "BEX4"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-BEX4 antibody is: synthetic peptide directed towards the N-terminal region of Human BEX4. Synthetic peptide located within the following region: PTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRHIEHNEAR |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 13 kDa |
| Gene Name | brain expressed X-linked 4 |
| Database Link | |
| Background | This gene is a member of the brain expressed X-linked gene family. The proteins encoded by some of the other members of this family act as transcription elongation factors which allow RNA polymerase II to escape pausing during elongation. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
| Synonyms | BEXL1 |
| Note | Human: 100%; Horse: 92%; Rabbit: 79% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.