RQCD1 (CNOT9) Rabbit Polyclonal Antibody

CAT#: TA331222

Rabbit Polyclonal Anti-RQCD1 Antibody

Product Images

Host: Rabbit; Target Name: RQCD1; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0ug/ml; RQCD1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RQCD1 antibody is: synthetic peptide directed towards the middle region of Human RQCD1. Synthetic peptide located within the following region: SLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: CCR4-NOT transcription complex subunit 9
• Database Link:
  NP_005435
  Entrez Gene 9125 Human
  UniProt ID Q92600
• Background: This gene encodes a member of the highly conserved RCD1 protein family. The encoded protein is a transcriptional cofactor and a core protein of the CCR4-NOT complex. It may be involved in signal transduction as well as retinoic acid-regulated cell differentiation and development. Alternatively spliced transcript variants have been described for this gene.
• Synonyms: CAF40; CT129; RCD-1; RCD1; RQCD1
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 86%; Goat: 79%

Reference Data

• Protein Pathways: RNA degradation