HIF 2 alpha (EPAS1) Rabbit Polyclonal Antibody

CAT#: TA330214

Reviews ()
Write a review

Rabbit Polyclonal Anti-EPAS1 Antibody


 Product Datasheet for 'TA330214'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-EPAS1 antibody: synthetic peptide directed towards the middle region of human EPAS1. Synthetic peptide located within the following region: ESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Predicted Protein Size 90 kDa
Gene Name endothelial PAS domain protein 1
Background EPAS1 is a transcription factor involved in the induction of oxygen regulated genes. EPAS1 binds to core DNA sequence 5'-[AG]CGTG-3' within the hypoxia response element (HRE) of target gene promoters. EPAS1 regulates the vascular endothelial growth factor (VEGF) expression and seems to be implicated in the development of blood vessels and the tubular system of lung. EPAS1 may also play a role in the formation of the endothelium that gives rise to the blood brain barrier. EPAS1 is a potent activator of the Tie-2 tyrosine kinase expression. The activation seems to require recruitment of transcriptional coactivators such as CREBPB and probably EP300. Interaction of EPAS1 with redox regulatory protein APEX seems to activate CTAD.
Synonyms bHLHe73; ECYT4; HIF2A; HLF; MOP2; PASD2
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Pathways in cancer, Renal cell carcinoma
Other products for "EPAS1"
Frequently bought together (2)
Transient overexpression lysate of endothelial PAS domain protein 1 (EPAS1)
    • 100 ug

USD 315.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
68 Mouse Clones