RFX1 Rabbit Polyclonal Antibody

CAT#: TA330043

Rabbit Polyclonal Anti-RFX1 Antibody

Product Images

WB Suggested Anti-RFX1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RFX1 antibody: synthetic peptide directed towards the C terminal of human RFX1. Synthetic peptide located within the following region: ESEDELPQDISLAAGGESPALGPETLEPPAKLARTDARGLFVQALPSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 105 kDa
• Gene Name: regulatory factor X1
• Database Link:
  NP_002909
  Entrez Gene 19724 MouseEntrez Gene 5989 Human
  UniProt ID P22670
• Background: RFX1 is a member of the regulatory factor X protein family, which are transcription factors that contain a highly-conserved winged helix DNA binding domain. RFX1 is structurally related to regulatory factors X2, X3, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with RFX family members X2, X3, and X5, but not with X4. This protein binds to the X-boxes of MHC class II genes and is essential for their expression. Also, it can bind to an inverted repeat that is required for expression of hepatitis B virus genes.This gene is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X2, X3, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with RFX family members X2, X3, and X5, but not with X4. This protein binds to the X-boxes of MHC class II genes and is essential for their expression. Also, it can bind to an inverted repeat that is required for expression of hepatitis B virus genes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: EFC; RFX
• Note: Immunogen sequence homology: Bovine: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Mouse: 92%; Pig: 92%; Rat: 92%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome