Products

cDNA Clones (11)
Antibodies (5)
Jump to Filters
View as table Download
MAS1 (NM_002377) Human Tagged ORF Clone
RG224124

USD 650.00

In Stock

MAS1 (tGFP-tagged) - Human MAS1 oncogene (MAS1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MAS1 (NM_002377) Human Tagged ORF Clone
RC224124

USD 450.00

In Stock

MAS1 (Myc-DDK-tagged)-Human MAS1 oncogene (MAS1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
MAS1 Rabbit Polyclonal Antibody
TA309741

USD 550.00

In Stock

Rabbit Polyclonal MAS1 Antibody

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Primate, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human MAS1 protein (between residues 75-125) [UniProt P04201]
MAS1 Rabbit Polyclonal Antibody
TA350156

USD 380.00

In Stock

Rabbit Polyclonal Anti-MAS1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MAS1
MAS1 Rabbit Polyclonal Antibody
TA339888

USD 539.00

5 Days

Rabbit Polyclonal Anti-MAS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAS1 antibody: synthetic peptide directed towards the middle region of human MAS1. Synthetic peptide located within the following region: VIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIII
MAS1 (NM_002377) Human Untagged Clone
SC118704

USD 450.00

In Stock

MAS1 (untagged)-Human MAS1 oncogene (MAS1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
MAS1 Rabbit Polyclonal Antibody
TA339887

USD 485.00

5 Days

Rabbit Polyclonal Anti-MAS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAS1 antibody: synthetic peptide directed towards the middle region of human MAS1. Synthetic peptide located within the following region: RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAI
MAS1 (NM_002377) Human Tagged ORF Clone Lentiviral Particle
RC224124L1V

USD 1,000.00

2 Weeks

Lenti ORF particles, MAS1 (Myc-DDK tagged) - Human MAS1 oncogene (MAS1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

MAS1 (NM_002377) Human Tagged ORF Clone Lentiviral Particle
RC224124L2V

USD 1,000.00

7 Weeks

Lenti ORF particles, MAS1 (mGFP-tagged) - Human MAS1 oncogene (MAS1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

MAS1 (NM_002377) Human Tagged ORF Clone Lentiviral Particle
RC224124L3V

USD 1,000.00

5 Weeks

Lenti ORF particles, MAS1 (Myc-DDK tagged) - Human MAS1 oncogene (MAS1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

MAS1 (NM_002377) Human Tagged ORF Clone Lentiviral Particle
RC224124L4V

USD 1,000.00

2 Weeks

Lenti ORF particles, MAS1 (mGFP-tagged) - Human MAS1 oncogene (MAS1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

MAS1 Rabbit Polyclonal Antibody
TA339886

USD 539.00

5 Days

Rabbit Polyclonal Anti-MAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAS1 antibody is: synthetic peptide directed towards the N-terminal region of Human MAS1. Synthetic peptide located within the following region: VTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLW