Products

cDNA Clones (7)
Proteins (5)
Antibodies (1)
Jump to Filters
View as table Download
UQCRQ (NM_014402) Human Tagged ORF Clone
RC213638

USD 150.00

In Stock

UQCRQ (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (UQCRQ), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
UQCRQ (NM_014402) Human Tagged ORF Clone Lentiviral Particle
RC213638L3V

USD 700.00

7 Weeks

Lenti ORF particles, UQCRQ (Myc-DDK tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (UQCRQ), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

UQCRQ (NM_014402) Human Tagged ORF Clone Lentiviral Particle
RC213638L4V

USD 700.00

7 Weeks

Lenti ORF particles, UQCRQ (mGFP-tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (UQCRQ), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

UQCRQ Rabbit Polyclonal Antibody
TA334394

USD 539.00

5 Days

Rabbit Polyclonal Anti-UQCRQ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UQCRQ antibody is: synthetic peptide directed towards the middle region of Human UQCRQ. Synthetic peptide located within the following region: KGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK
UQCRQ (NM_014402) Human Tagged ORF Clone
RG213638

USD 350.00

3 Weeks

UQCRQ (tGFP-tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (UQCRQ), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
UQCRQ (NM_014402) Human Tagged Lenti ORF Clone
RC213638L3

USD 450.00

3 Weeks

Lenti ORF clone of Human ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (UQCRQ), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UQCRQ (NM_014402) Human Tagged Lenti ORF Clone
RC213638L4

USD 450.00

3 Weeks

Lenti ORF clone of Human ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (UQCRQ), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UQCRQ (1-82, His-tag) Human Protein
AR51147PU-N

USD 1,245.00

3 Weeks

UQCRQ (1-82, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
UQCRQ (1-82, His-tag) Human Protein
AR51147PU-S

USD 510.00

3 Weeks

UQCRQ (1-82, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
UQCRQ (NM_014402) Human Over-expression Lysate
LC415296

USD 134.00

2 Weeks

UQCRQ HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
UQCRQ (NM_014402) Human Over-expression Lysate
LY415296

USD 436.00

5 Days

Transient overexpression lysate of ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (UQCRQ), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T
UQCRQ (NM_014402) Human Untagged Clone
SC115007

USD 150.00

4 Weeks

UQCRQ (untagged)-Human ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (UQCRQ), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
UQCRQ CytoSection
TS413638P5

USD 1,174.00

4 Weeks

Transient overexpression of UQCRQ in HEK293T cells, FFPE control for IHC, ICC and ISH staining, 25 slides per pack

Other Names MC3DN4; QCR8; QP-C; QPC; UQCR7
Accession Number NM_014402, NP_055217