UQCRQ Rabbit Polyclonal Antibody

CAT#: TA334394

Rabbit Polyclonal Anti-UQCRQ Antibody

Product Images

WB Suggested Anti-UQCRQ Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Liver

• 

  Host: Rabbit; Target Name: UQCRQ; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: UQCRQ; Sample Tissue: Human MCF7; Antibody Dilution: 1.0 ug/ml; UQCRQ is supported by BioGPS gene expression data to be expressed in MCF7

• 

  Host: Rabbit; Target Name: UQCRQ; Sample Tissue: Human 721_B; Antibody Dilution: 1.0 ug/ml; UQCRQ is supported by BioGPS gene expression data to be expressed in 721_B

• 

  Host: Rabbit; Target Name: UQCRQ; Sample Tissue: Human Hela; Antibody Dilution: 1.0 ug/ml; UQCRQ is supported by BioGPS gene expression data to be expressed in HeLa

• 

  Host: Rabbit; Target Name: UQCRQ; Sample Tissue: Human Fetal Kidney; Antibody Dilution: 1.0 ug/ml

• Host: Rabbit; Target Name: UQCRQ; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• Host: Rabbit; Target Name: UQCRQ; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

Show all 8 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UQCRQ antibody is: synthetic peptide directed towards the middle region of Human UQCRQ. Synthetic peptide located within the following region: KGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 10 kDa
• Gene Name: ubiquinol-cytochrome c reductase complex III subunit VII
• Database Link:
  NP_055217
  Entrez Gene 27089 Human
  UniProt ID O14949
• Background: This gene encodes a ubiquinone-binding protein of low molecular mass. This protein is a small core-associated protein and a subunit of ubiquinol-cytochrome c reductase complex III, which is part of the mitochondrial respiratory chain.
• Synonyms: MC3DN4; QCR8; QP-C; QPC; UQCR7
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Bovine: 100%; Rat: 92%; Mouse: 92%; Rabbit: 92%; Guinea pig: 92%

Reference Data

• Protein Pathways: Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease