Rabbit Polyclonal EPAC1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | EPAC1 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human EPAC1. |
Rabbit Polyclonal EPAC1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | EPAC1 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human EPAC1. |
Rabbit Polyclonal Anti-RAPGEF3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAPGEF3 antibody: synthetic peptide directed towards the middle region of human RAPGEF3. Synthetic peptide located within the following region: HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS |
Rabbit anti-RAPGEF3 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RAPGEF3 |
Rabbit Polyclonal Anti-RAPGEF3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAPGEF3 antibody: synthetic peptide directed towards the N terminal of human RAPGEF3. Synthetic peptide located within the following region: RSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEME |