Products

Proteins (2)
Antibodies (1)
Jump to Filters
View as table Download
ACADSB (NM_001609) Human Over-expression Lysate
LC419848

USD 134.00

In Stock

ACADSB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ACADSB (NM_001609) Human Over-expression Lysate
LY419848

USD 436.00

In Stock

Transient overexpression lysate of acyl-Coenzyme A dehydrogenase, short/branched chain (ACADSB), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ACADSB Rabbit Polyclonal Antibody
TA335016

USD 539.00

5 Days

Rabbit Polyclonal Anti-ACADSB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACADSB antibody: synthetic peptide directed towards the middle region of human ACADSB. Synthetic peptide located within the following region: GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG