Products

View as table Download

Rabbit Polyclonal Anti-GOT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GOT1

Rabbit Polyclonal Anti-GOT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV

Rabbit Polyclonal Anti-GOT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV

Transient overexpression lysate of glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) (GOT1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Goat Polyclonal Antibody against GOT1 (Internal region)

Applications WB
Reactivities Human (Expected from sequence similarity: Rat)
Conjugation Unconjugated
Immunogen Peptide with sequence C-RSYRYWDAEKR, from the internal region of the protein sequence according to NP_002070.1.

Rabbit anti-GOT1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GOT1

Aspartate Aminotransferase (GOT1) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human GOT1

Goat Polyclonal Antibody against GOT1

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse)
Conjugation Unconjugated
Immunogen Peptide with sequence C-TADFREDPDPRKVN, from the internal region of the protein sequence according to NP_002070.1.