Research Areas

cDNA Clones (11)
Antibodies (7)
Proteins (6)
Jump to Filters
View as table Download
WNT3A (NM_033131) Human Tagged ORF Clone
RC213639

USD 457.00

In Stock

WNT3A (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 3A (WNT3A)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
WNT3A (NM_033131) Human Tagged ORF Clone Lentiviral Particle
RC213639L4V

USD 1,007.00

2 Weeks

Lenti ORF particles, WNT3A (mGFP-tagged) - Human wingless-type MMTV integration site family, member 3A (WNT3A), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

WNT3A (NM_033131) Human Tagged ORF Clone Lentiviral Particle
RC213639L1V

USD 1,007.00

7 Weeks

Lenti ORF particles, WNT3A (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 3A (WNT3A), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

WNT3A (NM_033131) Human Tagged ORF Clone Lentiviral Particle
RC213639L2V

USD 1,007.00

2 Weeks

Lenti ORF particles, WNT3A (mGFP-tagged) - Human wingless-type MMTV integration site family, member 3A (WNT3A), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

WNT3A (NM_033131) Human Tagged ORF Clone Lentiviral Particle
RC213639L3V

USD 1,007.00

7 Weeks

Lenti ORF particles, WNT3A (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 3A (WNT3A), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

WNT3A (NM_033131) Human Tagged ORF Clone
RG213639

USD 657.00

In Stock

WNT3A (tGFP-tagged) - Human wingless-type MMTV integration site family, member 3A (WNT3A)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
WNT3A Rabbit Monoclonal Antibody [Clone ID: OTIR4G6]
TA592927

USD 428.00

In Stock

WNT3A Rabbit monoclonal antibody,clone OTIR4G6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
WNT3A (NM_033131) Human Untagged Clone
SC305570

USD 686.00

In Stock

WNT3A (untagged)-Human wingless-type MMTV integration site family, member 3A (WNT3A)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
WNT3A Rabbit Polyclonal Antibody
TA349804

USD 380.00

In Stock

Rabbit Polyclonal Anti-WNT3A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human WNT3A
WNT3A Mouse Monoclonal Antibody [Clone ID: 3A6]
AM09053PU-N

USD 430.00

3 Weeks

WNT3A mouse monoclonal antibody, clone 3A6, Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
WNT3A Mouse Monoclonal Antibody [Clone ID: 3A6]
AM09053PU-S

USD 315.00

3 Weeks

WNT3A mouse monoclonal antibody, clone 3A6, Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
WNT3A (19-352) Human Protein
AR51759PU-S

USD 420.00

2 Weeks

WNT3A (19-352) human recombinant protein, 0.1 mg

Expression Host E. coli
WNT3A (NM_033131) Human Tagged Lenti ORF Clone
RC213639L2

USD 757.00

In Stock

Lenti ORF clone of Human wingless-type MMTV integration site family, member 3A (WNT3A), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
WNT3A (NM_033131) Human Tagged Lenti ORF Clone
RC213639L4

USD 757.00

In Stock

Lenti ORF clone of Human wingless-type MMTV integration site family, member 3A (WNT3A), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
WNT3A Rabbit Polyclonal Antibody
TA344189

USD 539.00

5 Days

Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA