WNT3A Rabbit Polyclonal Antibody

CAT#: TA344189

Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region

Product Images

WB Suggested Anti-Wnt3a Antibody Titration: 1 ug/ml; Positive Control: Mouse Heart lysate

• 

  Host: Rabbit; Target Name: Wnt3a; Sample Tissue: Mouse Heart; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:1 ug/ml; Peptide Concentration: 5ug/ml; Lysate Quantity: 25ug/lane; Gel Concentration: 0.12%

• 

  Immunohistochemistry with Placenta tissue at an antibody concentration of Dilution: 1:500 using anti-Wnt3a antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: Wnt family member 3A
• Database Link:
  NP_149122
  Entrez Gene 22416 MouseEntrez Gene 89780 Human
  UniProt ID P56704
• Background: Wnt3a is a ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.
• Synonyms: MGC119418; MGC119419; MGC119420
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Horse: 93%; Guinea pig: 93%; Rabbit: 86%; Zebrafish: 75%

Reference Data

• Protein Families: Adult stem cells, Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Secreted Protein, Stem cell relevant signaling - Wnt Signaling pathway
• Protein Pathways: Basal cell carcinoma, Hedgehog signaling pathway, Melanogenesis, Pathways in cancer, Wnt signaling pathway