Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Rabbit polyclonal HLA-B Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-90 amino acids from the N-terminal region of human HLA-B. |
Rabbit polyclonal antibody to CD74 (CD74 molecule, major histocompatibility complex, class II invariant chain)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Chimpanzee) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 58 of CD74 (Uniprot ID#P04233) |
Rabbit polyclonal antibody to HLA-DMA (major histocompatibility complex, class II, DM alpha)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 52 and 245 of HLA-DMA |
Rabbit polyclonal Anti-HLA-F Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT |
HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HLA-DRA |
Rabbit anti-HLA-A Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HLA-A |
Germany
Japan
United Kingdom
China
