Pro-B cell

cDNA Clones (11)
Proteins (7)
Antibodies (1)
Jump to Filters
View as table Download
PLA2G12B (NM_032562) Human Tagged ORF Clone
RC210905

USD 300.00

In Stock

PLA2G12B (Myc-DDK-tagged)-Human phospholipase A2, group XIIB (PLA2G12B)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PLA2G12B (NM_032562) Human Tagged ORF Clone Lentiviral Particle
RC210905L1V

USD 850.00

2 Weeks

Lenti ORF particles, PLA2G12B (Myc-DDK tagged) - Human phospholipase A2, group XIIB (PLA2G12B), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

PLA2G12B (NM_032562) Human Tagged ORF Clone Lentiviral Particle
RC210905L2V

USD 850.00

7 Weeks

Lenti ORF particles, PLA2G12B (mGFP-tagged) - Human phospholipase A2, group XIIB (PLA2G12B), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

PLA2G12B (NM_032562) Human Tagged ORF Clone Lentiviral Particle
RC210905L3V

USD 850.00

5 Weeks

Lenti ORF particles, PLA2G12B (Myc-DDK tagged) - Human phospholipase A2, group XIIB (PLA2G12B), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

PLA2G12B (NM_032562) Human Tagged ORF Clone Lentiviral Particle
RC210905L4V

USD 850.00

7 Weeks

Lenti ORF particles, PLA2G12B (mGFP-tagged) - Human phospholipase A2, group XIIB (PLA2G12B), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

PLA2G12B (NM_032562) Human Recombinant Protein
TP310905

USD 867.00

In Stock

Recombinant protein of human phospholipase A2, group XIIB (PLA2G12B), 20 µg

Tag C-Myc/DDK
Expression Host HEK293T
PLA2G12B (NM_032562) Human Tagged ORF Clone
RG210905

USD 500.00

In Stock

PLA2G12B (tGFP-tagged) - Human phospholipase A2, group XIIB (PLA2G12B)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PLA2G12B (NM_032562) Human Recombinant Protein
TP310905L

USD 9,200.00

6 Weeks

Recombinant protein of human phospholipase A2, group XIIB (PLA2G12B), 1 mg

Tag C-Myc/DDK
Expression Host HEK293T
PLA2G12B (NM_032562) Human Recombinant Protein
TP310905M

USD 2,950.00

6 Weeks

Recombinant protein of human phospholipase A2, group XIIB (PLA2G12B), 100 µg

Tag C-Myc/DDK
Expression Host HEK293T
PLA2G12B (NM_032562) Human Tagged Lenti ORF Clone
RC210905L2

USD 600.00

3 Weeks

Lenti ORF clone of Human phospholipase A2, group XIIB (PLA2G12B), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PLA2G12B (NM_032562) Human Tagged Lenti ORF Clone
RC210905L3

USD 600.00

3 Weeks

Lenti ORF clone of Human phospholipase A2, group XIIB (PLA2G12B), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PLA2G12B (NM_032562) Human Tagged Lenti ORF Clone
RC210905L4

USD 600.00

3 Weeks

Lenti ORF clone of Human phospholipase A2, group XIIB (PLA2G12B), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PLA2G12B Rabbit Polyclonal Antibody
TA333609

USD 539.00

5 Days

Rabbit Polyclonal Anti-PLA2G12B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PLA2G12B Antibody is: synthetic peptide directed towards the N-terminal region of Human PLA2G12B. Synthetic peptide located within the following region: LVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELL
PLA2G12B (NM_032562) Human Over-expression Lysate
LC409997

USD 134.00

2 Weeks

PLA2G12B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T