USD 458.00
In Stock
CTNNB1 mouse monoclonal capture antibody, validated for Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Dog, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700034, TA700035 |
USD 458.00
In Stock
CTNNB1 mouse monoclonal capture antibody, validated for Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Dog, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700034, TA700035 |
USD 494.00
In Stock
CTNNB1 biotinylated mouse monoclonal detection antibody, validated for Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Matched ELISA Pair | TA600035, TA600047, TA600141 |
USD 494.00
In Stock
CTNNB1 biotinylated mouse monoclonal detection antibody, validated for Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Matched ELISA Pair | TA600035, TA600034 |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal E2F1 Antibody
Applications | ELISA, IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
USD 229.00
USD 458.00
In Stock
CTNNB1 mouse monoclonal capture antibody, validated for Luminex assays
Applications | LMNX |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700034, TA700141 |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
USD 458.00
In Stock
CTNNB1 mouse monoclonal capture antibody, validated for ELISA and Luminex assays
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700035 |
USD 458.00
2 Weeks
CTNNB1 mouse monoclonal capture antibody, validated for Luminex assays
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700035, TA700047 |
USD 494.00
2 Weeks
CTNNB1 biotinylated mouse monoclonal detection antibody, validated for Luminex assays
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Matched ELISA Pair | TA600034 |
Rabbit Polyclonal MDM2 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal MDM2 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal MDM2 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
USD 425.00
2 Weeks
p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
EP300 rabbit polyclonal antibody, Supernatant
Applications | ELISA, EMSA, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | P300 peptide corresponding to a region near the N-terminus of the Human protein conjugated to KLH. |