Antibodies

Jump to Filters
View as table Download
ZNF606 Rabbit Polyclonal Antibody
TA333658

USD 539.00

5 Days

Rabbit Polyclonal Anti-ZNF606 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZNF606 Antibody: synthetic peptide directed towards the N terminal of human ZNF606. Synthetic peptide located within the following region: WHVEGSLEEGRRATGLPAAQVQEPVTFKDVAVDFTQEEWGQLDLVQRTLY
ZNF606 Rabbit Polyclonal Antibody
TA355624

USD 539.00

5 Days

ZNF606 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ZNF606