Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against VPS25
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QPNVDTRQKQ, from the internal region of the protein sequence according to NP_115729.1. |
Rabbit Polyclonal Anti-VPS25 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-VPS25 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Vps25 antibody is: synthetic peptide directed towards the C-terminal region of Rat Vps25. Synthetic peptide located within the following region: LYELTSGEDTEEEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF |
VPS25 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse VPS25 |
VPS25 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Active filters
Target Symbol
- VPS25