Germany
Japan
United Kingdom
China
Antibodies
View as table Download
UFM1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human UFM1 (NP_057701.1). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-UFM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UFM1 antibody: synthetic peptide directed towards the middle region of human UFM1. Synthetic peptide located within the following region: LSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKH |
Active filters
Target Symbol
- UFM1