Antibodies

View as table Download

TMEM33 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Dog, Gorilla, Human, Monkey, Pig, Gibbon, Horse (Predicted: Mouse, Rat, Hamster, Rabbit, Chicken, Xenopus, Zebrafish)
Conjugation Unconjugated
Immunogen TMEM33 antibody was raised against synthetic 18 amino acid peptide from internal region of human TMEM33. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Dog, Bat, Elephant, Panda, Horse, Pig, Opossum, Platypus (100%); Mouse, Rat, Hamster, Rabbit, Turkey, Chicken, Lizard, Xenopus, Zebrafish (94%); Catfish, Salmon, Stickleback, Sea anemone (89%); Drosophila (83%).

Rabbit Polyclonal Anti-Tmem33 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Tmem33 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LLHAATYTKKVLDAKGSNSLPLLRSVLDKLSTNQQNILKFIACNEIFLMP