Antibodies

Jump to Filters
View as table Download
TRMT6 Rabbit Polyclonal Antibody
TA345095

USD 539.00

5 Days

Rabbit Polyclonal Anti-TRMT6 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRMT6 antibody: synthetic peptide directed towards the middle region of human TRMT6. Synthetic peptide located within the following region: GAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFLSGLYEFPLNKVDS
TRMT6 Rabbit Polyclonal Antibody
TA382853

USD 365.00

3 Weeks

TRMT6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human TRMT6 (NP_057023.2).
Modifications Unmodified