Antibodies

View as table Download

Rabbit Polyclonal Anti-TIGIT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TIGIT antibody is: synthetic peptide directed towards the C-terminal region of Human TIGIT. Synthetic peptide located within the following region: ALRIHSVEGDLRRKSAGQEEWSPSAPSPPGSCVQAEAAPAGLCGEQRGED

TIGIT Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human TIGIT.
Modifications Unmodified