TFDP2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
TFDP2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit polyclonal anti-Tfdp2 antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Tfdp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GLLLNSTQSVSNLDPTTGATVPQSSVNQGLCLDAEVALATGQLPASNSHQ |
Rabbit polyclonal anti-Tfdp2 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Tfdp2 antibody is: synthetic peptide directed towards the N-terminal region of Rat Tfdp2. Synthetic peptide located within the following region: IDSDFSESKRSKKGDKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVSE |