Antibodies

View as table Download

TFDP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit polyclonal anti-Tfdp2 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Tfdp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GLLLNSTQSVSNLDPTTGATVPQSSVNQGLCLDAEVALATGQLPASNSHQ

Rabbit polyclonal anti-Tfdp2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Tfdp2 antibody is: synthetic peptide directed towards the N-terminal region of Rat Tfdp2. Synthetic peptide located within the following region: IDSDFSESKRSKKGDKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVSE