Rabbit Polyclonal SHISA9 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SHISA9 antibody was raised against a 22 amino acid synthetic peptide near the center of human SHISA9. |
Rabbit Polyclonal SHISA9 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SHISA9 antibody was raised against a 22 amino acid synthetic peptide near the center of human SHISA9. |
Rabbit Polyclonal Anti-SHISA9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SHISA9 antibody is: synthetic peptide directed towards the middle region of Human SHISA9. Synthetic peptide located within the following region: NYDTPLWLNTGKPPARKDDPLHDPTKDKTNLIVYIICGVVAVMVLVGIFT |
Shisa9 rabbit polyclonal antibody, Serum
Applications | ELISA, IHC, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides derived from C term domain of mouse CKAMP44 protein |