Antibodies

Jump to Filters
View as table Download
SHISA9 Rabbit Polyclonal Antibody
TA320200

USD 570.00

5 Days

Rabbit Polyclonal SHISA9 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SHISA9 antibody was raised against a 22 amino acid synthetic peptide near the center of human SHISA9.
SHISA9 Rabbit Polyclonal Antibody
TA330841

USD 539.00

5 Days

Rabbit Polyclonal Anti-SHISA9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SHISA9 antibody is: synthetic peptide directed towards the middle region of Human SHISA9. Synthetic peptide located within the following region: NYDTPLWLNTGKPPARKDDPLHDPTKDKTNLIVYIICGVVAVMVLVGIFT
Shisa9 Rabbit Polyclonal Antibody
AP55230SU-N

USD 655.00

5 Weeks

Shisa9 rabbit polyclonal antibody, Serum

Applications ELISA, IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Synthetic peptides derived from C term domain of mouse CKAMP44 protein