Antibodies

Jump to Filters
View as table Download
STK38 Rabbit Polyclonal Antibody
TA382137

USD 365.00

3 Weeks

STK38 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human STK38 (NP_009202.1).
Modifications Unmodified
STK38 (C-term) Rabbit Polyclonal Antibody
AP13643PU-N

USD 580.00

2 Weeks

STK38 (C-term) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human STK38.
STK38 Goat Polyclonal Antibody
TA309508

USD 520.00

5 Days

Goat Polyclonal Antibody against NDR1 / STK38

Applications WB
Reactivities Human, Rat (Expected from sequence similarity: Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-KPTVATSNHPET, from the C Terminus (near) of the protein sequence according to NP_009202.1.
STK38 Rabbit Polyclonal Antibody
TA346762

USD 539.00

5 Days

Rabbit Polyclonal Anti-STK38 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STK38 antibody: synthetic peptide directed towards the C terminal of human STK38. Synthetic peptide located within the following region: IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD