Antibodies

View as table Download

Rabbit Polyclonal SPRYD4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SPRYD4 antibody was raised against an 18 amino acid synthetic peptide near the center of human SPRYD4.

Rabbit Polyclonal Anti-SPRYD4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPRYD4 antibody is: synthetic peptide directed towards the N-terminal region of Human SPRYD4. Synthetic peptide located within the following region: SLRLCRWGAKRLGVASTEAQRGVSFKLEEKTAHSSLALFRDDMGVKYGLV