Rabbit Polyclonal SPRYD4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SPRYD4 antibody was raised against an 18 amino acid synthetic peptide near the center of human SPRYD4. |
Rabbit Polyclonal SPRYD4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SPRYD4 antibody was raised against an 18 amino acid synthetic peptide near the center of human SPRYD4. |
Rabbit Polyclonal Anti-SPRYD4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SPRYD4 antibody is: synthetic peptide directed towards the N-terminal region of Human SPRYD4. Synthetic peptide located within the following region: SLRLCRWGAKRLGVASTEAQRGVSFKLEEKTAHSSLALFRDDMGVKYGLV |