Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal antibody to SOX13 (SRY (sex determining region Y)-box 13)
| Applications | IF, IP, WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 75 and 520 of SOX13 (Uniprot ID#Q9UN79) |
Rabbit Polyclonal Anti-SOX13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX13 antibody: synthetic peptide directed towards the C terminal of human SOX13. Synthetic peptide located within the following region: VIVNTCSLREEGEGTDDRHSVADGEMYRYSEDEDSEGEEKSDGELVVLTD |
Rabbit Polyclonal Anti-SOX13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX13 antibody: synthetic peptide directed towards the middle region of human SOX13. Synthetic peptide located within the following region: PVIVNTCSLREEGEGTDDRHSVADGEMYRYSEDEDSEGEEKSDGELVVLT |
Rabbit Polyclonal Anti-SOX13 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX13 antibody: synthetic peptide directed towards the middle region of human SOX13. Synthetic peptide located within the following region: TARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPM |
SOX13 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SOX13 |
Active filters
Target Symbol
- SOX13