Rabbit polyclonal anti-RNF125 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RNF125. |
Rabbit polyclonal anti-RNF125 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RNF125. |
Rabbit Polyclonal Anti-RNF125 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RNF125 antibody: synthetic peptide directed towards the middle region of human RNF125. Synthetic peptide located within the following region: ENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNH |
RNF125 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human RNF125 (NP_060301.2). |
Modifications | Unmodified |
RNF125 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human RNF125 (NP_060301.2). |
Modifications | Unmodified |