Antibodies

View as table Download

Rabbit Polyclonal Anti-RBM9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBM9 antibody: synthetic peptide directed towards the middle region of human RBM9. Synthetic peptide located within the following region: TAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAP

RBFOX2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RBFOX2

RBFOX2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RBFOX2

Rabbit polyclonal anti-Rbfox2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Rbfox2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Rbfox2. Synthetic peptide located within the following region: PVPGAGADGPEPGLSKRPRTEEAADGGMQNEPLTPGYHGFPARDGQGNQE

Rabbit Polyclonal Anti-Rbm9 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Rbm9 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QPATATAATAAAAAAAAYSDGYGRVYTADPYHALAPAASYGVGAVASLYR

Rabbit Polyclonal Anti-RBM9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBM9 antibody: synthetic peptide directed towards the middle region of human RBM9. Synthetic peptide located within the following region: PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT

Rabbit Polyclonal Anti-RBM9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBM9 antibody: synthetic peptide directed towards the N terminal of human RBM9. Synthetic peptide located within the following region: STQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRL

Rabbit Polyclonal Anti-RBM9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBM9 antibody: synthetic peptide directed towards the N terminal of human RBM9. Synthetic peptide located within the following region: GSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKR