Rabbit Polyclonal Anti-RALY Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RALY Antibody: synthetic peptide directed towards the C terminal of human RALY. Synthetic peptide located within the following region: GGGSSRPPAPQENTTSEAGLPQGEARTRDDGDEEGLLTHSEEELEHSQDT |
Rabbit Polyclonal Anti-RALY Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RALY antibody: synthetic peptide directed towards the N terminal of human RALY. Synthetic peptide located within the following region: NKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQ |
Rabbit polyclonal anti-RALY antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RALY. |
RALY (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 74-103 amino acids from the Central region of human RALY |
Rabbit Polyclonal Anti-RALY Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RALY Antibody: synthetic peptide directed towards the middle region of human RALY. Synthetic peptide located within the following region: TQIKSNIDALLSRLEQIAAEQKANPDGKKKGDGGGAGGGGGGGGSGGGGS |
Rabbit Polyclonal Anti-RALY Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RALY antibody: synthetic peptide directed towards the middle region of human RALY. Synthetic peptide located within the following region: KIKLKSSELQAIKTELTQIKSNIDALLSRLEQIAAEQKANPDGKKKGDGG |
Raly (R103) polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 70-120 of Human Raly. |
Germany
Japan
United Kingdom
China
