Antibodies

View as table Download

Rabbit polyclonal POU4F2 Antibody (C-term)

Applications WB
Reactivities Human (Predicted: Mouse)
Conjugation Unconjugated
Immunogen This POU4F2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 311-339 amino acids from the C-terminal region of human POU4F2.

Rabbit Polyclonal Anti-POU4F2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POU4F2 antibody: synthetic peptide directed towards the N terminal of human POU4F2. Synthetic peptide located within the following region: MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSTSPGSSAPIAPSASSPSSS

Rabbit Polyclonal Anti-POU4F2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POU4F2 antibody: synthetic peptide directed towards the middle region of human POU4F2. Synthetic peptide located within the following region: LEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAGI