Rabbit Polyclonal Anti-PITX1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PITX1 antibody: synthetic peptide directed towards the N terminal of human PITX1. Synthetic peptide located within the following region: PADPREPLENSASESSDTELPEKERGGEPKGPEDSGAGGTGCGGADDPAK |
Rabbit polyclonal anti-PITX1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PITX1. |
Rabbit Polyclonal Anti-PITX1 Antibody
| Applications | WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PITX1 Antibody: synthetic peptide directed towards the C terminal of human PITX1. Synthetic peptide located within the following region: GTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS |
Rabbit Polyclonal Anti-PITX1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PITX1 antibody: synthetic peptide directed towards the middle region of human PITX1. Synthetic peptide located within the following region: YVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLS |
Pitx1 Antibody - middle region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
