Antibodies

View as table Download

PTAR1 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human PTAR1

Rabbit Polyclonal Anti-PTAR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PTAR1 Antibody is: synthetic peptide directed towards the C-terminal region of Human PTAR1. Synthetic peptide located within the following region: LISQTVIDSSVMEQNPLRSEPALVPPKDEEAAVSTEEPRINLPHLLEEEV