Antibodies

View as table Download

Goat Polyclonal Antibody against PRDM4

Applications WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence CSAVYSADESLSAHK, from the C Terminus of the protein sequence according to NP_036538.

Rabbit Polyclonal anti-Prdm4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Prdm4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Prdm4. Synthetic peptide located within the following region: HLKTCKEPSSSSSAQEEEDDESEEEDLADSMRTEDCRMGSAVYSTDESLS

Rabbit Polyclonal Anti-PRDM4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDM4 antibody: synthetic peptide directed towards the C terminal of human PRDM4. Synthetic peptide located within the following region: GPTSSSSAPEEEEEDDSEEEDLADSVGTEDCRINSAVYSADESLSAHK

Recombinant Anti-PRDM4 (Clone RAB-C367)

Applications ChIP, ELISA, IF
Reactivities Human
Conjugation His Tag

Recombinant Anti-PRDM4 (Clone RAB-C367)

Applications ChIP, ELISA, IF
Reactivities Human
Conjugation Unconjugated