Germany
Japan
United Kingdom
China
Antibodies
View as table Download
PAAF1 mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) PAAF1 mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
USD 509.00
2 Weeks
PAAF1 mouse monoclonal antibody, clone OTI2G6 (formerly 2G6), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
PAAF1 mouse monoclonal antibody, clone OTI2G6 (formerly 2G6), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit Polyclonal Anti-PAAF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PAAF1 Antibody is: synthetic peptide directed towards the N-terminal region of Human PAAF1. Synthetic peptide located within the following region: FTVNEINKKSIHISCPKENASSKFLAPYTTFSRIHTKSITCLDISSRGGL |
PAAF1 mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- PAAF1