Antibodies

Jump to Filters
View as table Download
Mu Opioid Receptor (OPRM1) Rabbit Polyclonal Antibody
TA372925

USD 380.00

4 Weeks

OPRM1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human OPRM1
Mu Opioid Receptor (OPRM1) Rabbit Polyclonal Antibody
TA379485

USD 365.00

3 Weeks

Mu Opioid Receptor(MOR) Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human Mu Opioid Receptor(MOR) (NP_000905.3).
Oprm1 Rabbit Polyclonal Antibody
TA338333

USD 539.00

In Stock

Rabbit Polyclonal Anti-Oprm1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Oprm1 antibody is: synthetic peptide directed towards the middle region of Mouse Oprm1. Synthetic peptide located within the following region: CYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV