NUBP1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 201-320 of human NUBP1 (NP_002475.2). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-NUBP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUBP1 antibody: synthetic peptide directed towards the N terminal of human NUBP1. Synthetic peptide located within the following region: MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKM |
Rabbit Polyclonal Anti-NUBP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUBP1 antibody: synthetic peptide directed towards the middle region of human NUBP1. Synthetic peptide located within the following region: SGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKG |
NUBP1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NUBP1 |
NUBP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 201-320 of human NUBP1 (NP_002475.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China