Antibodies

View as table Download

NUBP1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 201-320 of human NUBP1 (NP_002475.2).
Modifications Unmodified

Rabbit Polyclonal Anti-NUBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NUBP1 antibody: synthetic peptide directed towards the N terminal of human NUBP1. Synthetic peptide located within the following region: MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKM

Rabbit Polyclonal Anti-NUBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NUBP1 antibody: synthetic peptide directed towards the middle region of human NUBP1. Synthetic peptide located within the following region: SGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKG

NUBP1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NUBP1

NUBP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 201-320 of human NUBP1 (NP_002475.2).
Modifications Unmodified