Mogat2 (C-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of mouse MOGT2. |
Goat Anti-MOGAT2 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Dog, Cow, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KESAAHILNRK, from the internal region of the protein sequence according to NP_079374.2. |
Rabbit Polyclonal Anti-MOGAT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MOGAT2 antibody: synthetic peptide directed towards the middle region of human MOGAT2. Synthetic peptide located within the following region: LLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGEN |
Germany
Japan
United Kingdom
China