Antibodies

Jump to Filters
View as table Download
MYLK4 Rabbit Polyclonal Antibody
TA337451

USD 539.00

5 Days

Rabbit Polyclonal Anti-MYLK4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MYLK4 antibody is: synthetic peptide directed towards the C-terminal region of Human MYLK4. Synthetic peptide located within the following region: EFISKLLIKEKSWRISASEALKHPWLSDHKLHSRLNAQKKKNRGSDAQDF
MYLK4 Rabbit Polyclonal Antibody
TA378859

USD 365.00

3 Weeks

MYLK4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 119-388 of human MYLK4 (NP_001012418.2).
Modifications Unmodified