Antibodies

View as table Download

Rabbit Polyclonal MLIP Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen MLIP antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of human MLIP.

Rabbit Polyclonal Anti-MLIP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MLIP Antibody is: synthetic peptide directed towards the N-terminal region of Human MLIP. Synthetic peptide located within the following region: VPTVRRLPTHTQLADTSKFLVKIPEESSDKSPETVNRSKSNDYLTLNAGS

Rabbit Polyclonal Anti-MLIP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MLIP Antibody is: synthetic peptide directed towards the middle region of Human MLIP. Synthetic peptide located within the following region: HGMAPQQKHGQQYKTKSSYKAFAAIPTNTLLLEQKALDEPAKTESVSKDN