Rabbit Polyclonal MLIP Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | MLIP antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of human MLIP. |
Rabbit Polyclonal MLIP Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | MLIP antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of human MLIP. |
Rabbit Polyclonal Anti-MLIP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MLIP Antibody is: synthetic peptide directed towards the N-terminal region of Human MLIP. Synthetic peptide located within the following region: VPTVRRLPTHTQLADTSKFLVKIPEESSDKSPETVNRSKSNDYLTLNAGS |
Rabbit Polyclonal Anti-MLIP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MLIP Antibody is: synthetic peptide directed towards the middle region of Human MLIP. Synthetic peptide located within the following region: HGMAPQQKHGQQYKTKSSYKAFAAIPTNTLLLEQKALDEPAKTESVSKDN |