Antibodies

View as table Download

Rabbit Polyclonal Anti-MBNL1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MBNL1 antibody: synthetic peptide directed towards the middle region of human MBNL1. Synthetic peptide located within the following region: AMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGI

MBNL1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-382 of human MBNL1 (NP_066368.2).
Modifications Unmodified

Goat Anti-MBNL1 Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-SAEHLTSHKYVTQ, from the C Terminus of the protein sequence according to NP_066368.2; NP_997175.1; NP_997176.1; NP_997177.1; NP_997178.1; NP_997179.1; NP_997180.1.

Rabbit Polyclonal Anti-MBNL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MBNL1 antibody: synthetic peptide directed towards the C terminal of human MBNL1. Synthetic peptide located within the following region: LCPQQQHLPQVFPSLQQPQPTSPILDASTLLGATSCPAAAAGKMIPIISA