Antibodies

View as table Download

KLHL35 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 308-336 amino acids from the C-terminal region of human KLHL35

Rabbit Polyclonal Anti-KLHL35 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLHL35 antibody: synthetic peptide directed towards the N terminal of human KLHL35. Synthetic peptide located within the following region: RPRRFMDLAEVIVVIGGCDRKGLLKLPFADAYHPESQRWTPLPSLPGYTR