Antibodies

Jump to Filters
View as table Download
ILRUN Rabbit Polyclonal Antibody
TA330715

USD 539.00

5 Days

Rabbit Polyclonal Anti-C6orf106 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-C6orf106 antibody is: synthetic peptide directed towards the C-terminal region of Human C6orf106. Synthetic peptide located within the following region: PAPDTWAPAPDQTEQDQNRLSQNSVNLSPSSHANNLSVVTYSKGLHGPYP
ILRUN Rabbit Polyclonal Antibody
TA362373

USD 539.00

5 Days

C6ORF106 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human C6ORF106