Antibodies

View as table Download

Anti-ILF2 mouse monoclonal antibody, clone OTI6F1 (formerly 6F1)

Applications IF, IHC, WB
Reactivities Human, Dog, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ILF2 mouse monoclonal antibody, clone OTI6F1 (formerly 6F1)

Applications IF, IHC, WB
Reactivities Human, Dog, Mouse
Conjugation Unconjugated

Anti-ILF2 mouse monoclonal antibody, clone OTI6F1 (formerly 6F1), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Dog, Mouse
Conjugation HRP

Anti-ILF2 mouse monoclonal antibody, clone OTI6F1 (formerly 6F1), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Dog, Mouse
Conjugation Biotin

Rabbit Polyclonal Anti-ILF2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ILF2 antibody: synthetic peptide directed towards the C terminal of human ILF2. Synthetic peptide located within the following region: HGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKPPEKKEGEEEEE

Anti-ILF2 mouse monoclonal antibody, clone OTI6F1 (formerly 6F1)

Applications IF, IHC, WB
Reactivities Human, Dog, Mouse
Conjugation Unconjugated

Goat Polyclonal Antibody against ILF2

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKAYEKPPEKKEG, from the internal region (near the C Terminus) of the protein sequence according to NP_004506.2.

Rabbit Polyclonal Anti-Ilf2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ilf2 antibody is: synthetic peptide directed towards the N-terminal region of MOUSE Ilf2. Synthetic peptide located within the following region: KRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSY

Rabbit Polyclonal Anti-ILF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ILF2 antibody is: synthetic peptide directed towards the N-terminal region of Human ILF2. Synthetic peptide located within the following region: FPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIV

ILF2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ILF2 (NP_004506.2).
Modifications Unmodified

ILF2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ILF2 (NP_004506.2).
Modifications Unmodified