Anti-ILF2 mouse monoclonal antibody, clone OTI6F1 (formerly 6F1)
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Mouse |
Conjugation | Unconjugated |
Anti-ILF2 mouse monoclonal antibody, clone OTI6F1 (formerly 6F1)
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ILF2 mouse monoclonal antibody, clone OTI6F1 (formerly 6F1)
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Mouse |
Conjugation | Unconjugated |
Anti-ILF2 mouse monoclonal antibody, clone OTI6F1 (formerly 6F1), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Mouse |
Conjugation | HRP |
Anti-ILF2 mouse monoclonal antibody, clone OTI6F1 (formerly 6F1), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Mouse |
Conjugation | Biotin |
Rabbit Polyclonal Anti-ILF2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ILF2 antibody: synthetic peptide directed towards the C terminal of human ILF2. Synthetic peptide located within the following region: HGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKPPEKKEGEEEEE |
Anti-ILF2 mouse monoclonal antibody, clone OTI6F1 (formerly 6F1)
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Mouse |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against ILF2
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EKAYEKPPEKKEG, from the internal region (near the C Terminus) of the protein sequence according to NP_004506.2. |
Rabbit Polyclonal Anti-Ilf2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Ilf2 antibody is: synthetic peptide directed towards the N-terminal region of MOUSE Ilf2. Synthetic peptide located within the following region: KRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSY |
Rabbit Polyclonal Anti-ILF2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ILF2 antibody is: synthetic peptide directed towards the N-terminal region of Human ILF2. Synthetic peptide located within the following region: FPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIV |
ILF2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ILF2 (NP_004506.2). |
Modifications | Unmodified |
ILF2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ILF2 (NP_004506.2). |
Modifications | Unmodified |