Rabbit Polyclonal Anti-HOXB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXB2 antibody: synthetic peptide directed towards the N terminal of human HOXB2. Synthetic peptide located within the following region: RAEDGPALPPPPPPPLPAAPPAPEFPWMKEKKSAKKPSQSATSPSPAASA |
Rabbit Polyclonal Anti-HOXB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HOXB2 |
Rabbit polyclonal anti-HOXB2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HOXB2. |
HOXB2 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-HOXB2 antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HOXB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 282-306 amino acids from the C-terminal region of human HOXB2. |
HOXB2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HOXB2 |
HOXB2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HOXB2. |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
