Antibodies

View as table Download

HMG20A rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human HMG20A

HMG20A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human HMG20A

HMG20A Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-347 of human HMG20A (NP_060670.1).
Modifications Unmodified

Goat Anti-HMG20A Antibody

Applications IHC
Reactivities Human, Rat (Expected from sequence similarity: Mouse, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-ATVREVVNRLDR, from the C Terminus of the protein sequence according to NP_060670.1.

Rabbit Polyclonal anti-HMG20A antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the N terminal of human HMG20A. Synthetic peptide located within the following region: MENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSGATSSTNNPE

Rabbit Polyclonal Anti-HMG20A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the middle region of human HMG20A. Synthetic peptide located within the following region: RKTQDRQKGKSHRQDAARQATHDHEKETEVKERSVFDIPIFTEEFLNHSK

Rabbit Polyclonal Anti-HMG20A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the middle region of human HMG20A. Synthetic peptide located within the following region: RKTQDRQKGKSHRQDAARQATHDHEKETEVKERSVFDIPIFTEEFLNHSK

Rabbit Polyclonal Anti-HMG20A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the N terminal of human HMG20A. Synthetic peptide located within the following region: ENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSGATSSTNNPEF

Rabbit Polyclonal Anti-HMG20A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the C terminal of human HMG20A. Synthetic peptide located within the following region: SMPLPGSGETPTVDTIDSYMNRLHSIILANPQDNENFIATVREVVNRLDR