HMG20A rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HMG20A |
HMG20A rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HMG20A |
HMG20A rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HMG20A |
HMG20A Rabbit polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-347 of human HMG20A (NP_060670.1). |
Modifications | Unmodified |
Goat Anti-HMG20A Antibody
Applications | IHC |
Reactivities | Human, Rat (Expected from sequence similarity: Mouse, Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ATVREVVNRLDR, from the C Terminus of the protein sequence according to NP_060670.1. |
Rabbit Polyclonal anti-HMG20A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the N terminal of human HMG20A. Synthetic peptide located within the following region: MENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSGATSSTNNPE |
Rabbit Polyclonal Anti-HMG20A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the middle region of human HMG20A. Synthetic peptide located within the following region: RKTQDRQKGKSHRQDAARQATHDHEKETEVKERSVFDIPIFTEEFLNHSK |
Rabbit Polyclonal Anti-HMG20A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the middle region of human HMG20A. Synthetic peptide located within the following region: RKTQDRQKGKSHRQDAARQATHDHEKETEVKERSVFDIPIFTEEFLNHSK |
Rabbit Polyclonal Anti-HMG20A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the N terminal of human HMG20A. Synthetic peptide located within the following region: ENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSGATSSTNNPEF |
Rabbit Polyclonal Anti-HMG20A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the C terminal of human HMG20A. Synthetic peptide located within the following region: SMPLPGSGETPTVDTIDSYMNRLHSIILANPQDNENFIATVREVVNRLDR |