Germany
Japan
United Kingdom
China
HDAC3 goat polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from the the internal region of Human HDAC3 (NP_003874.2). |
Antibodies
View as table Download
Anti-HDAC3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 414-428 amino acids of Human histone deacetylase 3 |
Rabbit Polyclonal anti-Hdac3 antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Hdac3 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: DVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI |
Rabbit Polyclonal Anti-HDAC3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDAC3 Antibody: A synthesized peptide derived from human HDAC3 |
HDAC3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HDAC3 |
| Modifications | Unmodified |
Rabbit monoclonal to human HDAC3
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal HDAC3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- HDAC3