Antibodies

Jump to Filters
View as table Download
GPR108 Rabbit Polyclonal Antibody
TA315632

USD 380.00

4 Weeks

Rabbit polyclonal anti-GP108 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GP108.
GPR108 Rabbit Polyclonal Antibody
TA334118

USD 539.00

5 Days

Rabbit Polyclonal Anti-GPR108 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR108 Antibody is: synthetic peptide directed towards the N-terminal region of Human GPR108. Synthetic peptide located within the following region: KPKSTPAVIQGPSGKDKDLVLGLSHLNNSYNFSFHVVIGSQAEEGQYSLN
GPR108 Rabbit Polyclonal Antibody
TA376718

USD 365.00

3 Weeks

GPR108 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 33-260 of human GPR108 (NP_001073921.1).
Modifications Unmodified